Basic Information | |
---|---|
Taxon OID | 3300034658 Open in IMG/M |
Scaffold ID | Ga0326751_017129 Open in IMG/M |
Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 524_CTD |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 771 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 13.5136 | Long. (o) | -44.9626 | Alt. (m) | Depth (m) | 2427 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052279 | Metagenome | 143 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326751_017129_584_769 | F052279 | AGGGGG | MTDELFALVWVLSFGLYLGIYTYWIPLRTQKKIESWLLSEESDETLLASLGVITNQIREQAL |
⦗Top⦘ |