Scaffold Ga0326748_012285

Overview

Basic Information

• Taxon OID: 3300034656
• Scaffold ID: Ga0326748_012285
• Source Dataset Name: Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1117
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 13.3325
  • Long. (^o): -44.9106
  • Depth (m): 2477

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059363	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0326748_012285_914_1102	F059363	AGGA	MILSKERIKEIKEIAYKNLMKADNWAHYRKDMKKEKYWSLYRADVRELLSIVKSLEEERDKC