Basic Information | |
---|---|
Taxon OID | 3300034655 Open in IMG/M |
Scaffold ID | Ga0326746_029328 Open in IMG/M |
Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 575 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 14.8216 | Long. (o) | -44.9298 | Alt. (m) | Depth (m) | 2800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020256 | Metagenome | 225 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326746_029328_140_346 | F020256 | N/A | MCVECGNASNDGKWFQVTVPTDRAAIEIELLKRPMNGRNPADAKNRNWEPGETVATLRQENTDHGIGG |
⦗Top⦘ |