Scaffold Ga0326741_035026

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326741_035026

Scaffold Ga0326741_035026

Overview

Basic Information
Taxon OID	3300034654 Open in IMG/M
Scaffold ID	Ga0326741_035026 Open in IMG/M
Source Dataset Name	Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	868
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	13.5136	Long. (^o)	-44.9628	Alt. (m)		Depth (m)	2244
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031124	Metagenome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326741_035026_235_483	F031124	N/A	MTKVKYKIEEKDERKVYDDIFEHVLHMLNDHSLPVELVASTLMAIGQRLYRTHLTDRSYHALMDIIHDTDVQPYDVKKERLH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.