| Basic Information | |
|---|---|
| Taxon OID | 3300034654 Open in IMG/M |
| Scaffold ID | Ga0326741_001973 Open in IMG/M |
| Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4480 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 13.5136 | Long. (o) | -44.9628 | Alt. (m) | Depth (m) | 2244 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020441 | Metagenome | 224 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326741_001973_2_121 | F020441 | N/A | EDSDKAKEMLTDYGAAFLLGWILGAGLGQTLWDSITGVL |
| ⦗Top⦘ |