Scaffold Ga0326741_000566

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326741_000566

Scaffold Ga0326741_000566

Overview

Basic Information
Taxon OID	3300034654 Open in IMG/M
Scaffold ID	Ga0326741_000566 Open in IMG/M
Source Dataset Name	Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9126
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (78.26%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	13.5136	Long. (^o)	-44.9628	Alt. (m)		Depth (m)	2244
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045148	Metagenome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326741_000566_5223_5447	F045148	GGA	VGVTAACDRCSTEDTVSVPAVSYAEWKNGGNIAWVFRNLSPQQRDILIGADTSRPMPYYLCQVCWDLTFEGEEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.