NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0372970_028710

Scaffold Ga0372970_028710


Overview

Basic Information
Taxon OID3300034648 Open in IMG/M
Scaffold IDGa0372970_028710 Open in IMG/M
Source Dataset NameMetatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1000_MSt9 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)863
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041787Metagenome / Metatranscriptome159N
F100583Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0372970_028710_1_315F041787N/AILKQGSPLTRTADGRYTLFDPTATPPQRFAGILSRDWQTDDNGNGIFRNCYPNCNMVEVSMYVNGVFRLRDMTITTDQLNAIVAQGRGYVHGDPNTLSGILQLF
Ga0372970_028710_328_861F100583GGAGGMPQVVENCILRTSFEFIQLARELLQTTPENMLGLQIMPDDNRAHDEYVLLKPRPFAGRVNWRGLNQNARPTRTPFAYEQNACIITPGYWAEYQELDEQMIRKVAQRGTHSARFDLTDYERELMMDISMKLHQTKESQIWQALVNGYVEERNDEGIAVWSQRYKIIRARFGISACDRQN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.