| Basic Information | |
|---|---|
| Taxon OID | 3300034647 Open in IMG/M |
| Scaffold ID | Ga0372968_041647 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 576 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5387 | Long. (o) | -110.798 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057399 | Metagenome / Metatranscriptome | 136 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0372968_041647_105_518 | F057399 | GAG | MSRTFERIATLEGHSYAYVDRDLAPNSYLYRVVQELPSGGRIESEAVEVVVHPAEETQVYVHGGIAPIGEAILVSWIRSAPEPLTFTLYDAAGRQVYTQQVFAAEGSQLIPSPNAAGVYLLEVAGSDIHRTYRVLWH |
| ⦗Top⦘ |