Scaffold Ga0371491_174596

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0371491_174596

Scaffold Ga0371491_174596

Overview

Basic Information
Taxon OID	3300034645 Open in IMG/M
Scaffold ID	Ga0371491_174596 Open in IMG/M
Source Dataset Name	Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome) (NovaSeq)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	552
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	New Zealand: Palmerston North, Manawatu-Wanganui
Coordinates	Lat. (^o)	-40.3794	Long. (^o)	175.6106	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039897	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0371491_174596_1_552	F039897	N/A	IKPGDPFLNEIDYFVKELDTMQQLPQLQYNDILSEAAKRELPSFRGNRGYIKYKRSDSIKGIVPEYYLVASPALAADDGADDPINVLTKILLDKQDTLKEGRDILCDPHFTQIGIAHEIFDNENRVIMIFATEYITDEPKFEIPFGNITELKRAFDILDEDGNQILRMNEIMETLKEMNFDKTD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.