| Basic Information | |
|---|---|
| Taxon OID | 3300034629 Open in IMG/M |
| Scaffold ID | Ga0326756_017322 Open in IMG/M |
| Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 836 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 14.7528 | Long. (o) | -44.9788 | Alt. (m) | Depth (m) | 2600 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055776 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326756_017322_343_531 | F055776 | GGAG | MQTDKKPIELSTQLFDVAKSYSNMSRVGQLYGRLNMIKDMQLYLVKEEIKVKKEIEENESNV |
| ⦗Top⦘ |