Scaffold Ga0326755_036964

Overview

Basic Information

• Taxon OID: 3300034628
• Scaffold ID: Ga0326755_036964
• Source Dataset Name: Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 14.7528
  • Long. (^o): -44.9788
  • Depth (m): 2961

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026590	Metagenome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326755_036964_3_302	F026590	N/A	NAGDRTSTGTDIHWFAQDIVETIKVRKGNPIDIQLDLITTNGSGTRQEGYTPSAPLLKTAVMKQFYESGISLHLHPDLSHADGVYKYKKSRISSLGQGA