NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326755_028561

Scaffold Ga0326755_028561


Overview

Basic Information
Taxon OID3300034628 Open in IMG/M
Scaffold IDGa0326755_028561 Open in IMG/M
Source Dataset NameSeawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)562
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)14.7528Long. (o)-44.9788Alt. (m)Depth (m)2961
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002744Metagenome / Metatranscriptome533Y

Sequences

Protein IDFamilyRBSSequence
Ga0326755_028561_60_560F002744N/AYGQPLVTNTVEPGIGATVIYSTTGTNGAESYYQRPTNETAAGTAINTRTQQADDISITGGNEITGLYTVVSGATATASEHDSGFSEFVSPDFNTSMPYRVAVQPTFTGLGAAANAITGGGGIMQYNMPRGQGIPLADKVTITTYYTNRDARAGGASNFINFVRYTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.