Scaffold Ga0373918_0015561

Overview

Basic Information

• Taxon OID: 3300034420
• Scaffold ID: Ga0373918_0015561
• Source Dataset Name: Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1713
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry → Uranium-Contaminated Sediments Microbial Communities After Treatment In Bioreactor, Oak Ridge, Tennessee, United States

Source Dataset Sampling Location

• Location Name: USA: Oak Ridge, Tennessee
• Coordinates
  • Lat. (^o): 36.0103
  • Long. (^o): -84.2696
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033859	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373918_0015561_899_1357	F033859	GGA	MLLLPLLTLLAFAAPAHAASQDVSPPMSEWRGYCSAYVAALDGKSDVSDLDVTYCLGMTKGLLSGLRIGAQIGALSFGSRLAVGYKLDADEVFKLFQQQDPSRILGICSPPTLNAADYVRAVLAHLEKSPADLQRPIGEVFFEGLQATWPCN