| Basic Information | |
|---|---|
| Taxon OID | 3300034404 Open in IMG/M |
| Scaffold ID | Ga0374090_05523 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1963 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Acidilobales → Acidilobaceae → Acidilobus → unclassified Acidilobus → Acidilobus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.69934 | Long. (o) | -110.76721 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008606 | Metagenome / Metatranscriptome | 330 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0374090_05523_1663_1941 | F008606 | AGG | VALVAEARDPEGDPEGRSYDKLVELSEQVNELRGQVVSLAERVARLEEENRWLRQELAEIKGAVREVRRNSVAILASILTVLVTVVISLIVH |
| ⦗Top⦘ |