Scaffold Ga0374090_02567

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0374090_02567

Scaffold Ga0374090_02567

Overview

Basic Information
Taxon OID	3300034404 Open in IMG/M
Scaffold ID	Ga0374090_02567 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4282
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.69934	Long. (^o)	-110.76721	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101502	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0374090_02567_3461_3784	F101502	N/A	MSQVPKAPIIAFTVILALGLGIVVIGSTSPIKPGIGAVLVLLASIACMPLAYWLRHPSLLITIELGVGVLLVIIIVNWLHGISPLTSLKWYYNALRTLITPLARLKP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.