NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0374090_02291

Scaffold Ga0374090_02291


Overview

Basic Information
Taxon OID3300034404 Open in IMG/M
Scaffold IDGa0374090_02291 Open in IMG/M
Source Dataset NameHot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4744
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.69934Long. (o)-110.76721Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000750Metagenome / Metatranscriptome908Y

Sequences

Protein IDFamilyRBSSequence
Ga0374090_02291_3341_3646F000750GGAMISIVITAVLFSYWLYKKLAKPRTFQFPIDIQTGDVIHGAFGSLLANLSLHVMYVDVMVGVLLYLTYQFTEFAVKQDTIYKDIATFMAGYFGTLVVGGIPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.