Scaffold Ga0374090_00079

Overview

Basic Information

• Taxon OID: 3300034404
• Scaffold ID: Ga0374090_00079
• Source Dataset Name: Hot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 41925
• Total Scaffold Genes: 37
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (51.35%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. WP30 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.69934
  • Long. (^o): -110.76721

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013155	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0374090_00079_913_1233	F013155	AGG	MELYQMAVIAIALANLAVTVWLLRLLIPLWRYLKKVVFVVDEYDFNRLISQFLNGEKPMSETIHIKTTENKEEGYKEITITRAYKKPLDAREIQENFVRQMAEKLQ