| Basic Information | |
|---|---|
| Taxon OID | 3300034396 Open in IMG/M |
| Scaffold ID | Ga0326777_031798 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S39 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 676 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -78.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038494 | Metagenome / Metatranscriptome | 165 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326777_031798_8_676 | F038494 | N/A | MGGKKSKAAKDGGKKGGKAVASFFKKVERKDFKMIEVSAFDDFFSKAQDPINTICDLSGSVATVNDNLSGLFAEAEVQAAGVAEGDMKALVAYYVKEIKKVDGGDFKVKLSDDFELDVQIKGKHAGHVETFVNHITEMVKAIVDFVKAAPDLVQQISDLAEECSAFPDKIQGLASEISPMKFPGAVKKTGENVKYMSAVPKDFKECFDNVKQFCTILKDCAEA |
| ⦗Top⦘ |