NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334917_069615

Scaffold Ga0334917_069615


Overview

Basic Information
Taxon OID3300034391 Open in IMG/M
Scaffold IDGa0334917_069615 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 13HMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)655
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062529Metagenome / Metatranscriptome130Y
F063433Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0334917_069615_2_313F063433GAGMTQSNRQTRTVPTPKVHEWLVWFGERATQDPKNTENRKLSNRLYDVCQRAGAPGSTIVARGTSAATSLEGPGGLSGVEWTTEEIPFTPRPGFGSKKVERLITRV
Ga0334917_069615_358_654F062529N/AMTTSQARETLDRLTEETAPLRRYGVATAAWIADYNDSLMAFVPQDKMPLFFIGKGCYVGDTVRPGAFVHGGHFRQLVERARINFDSLLIERHQQPPTR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.