Scaffold Ga0334917_062144

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334917_062144

Scaffold Ga0334917_062144

Overview

Basic Information
Taxon OID	3300034391 Open in IMG/M
Scaffold ID	Ga0334917_062144 Open in IMG/M
Source Dataset Name	Biocrust microbial communities from Mojave Desert, California, United States - 13HMC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	688
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.7856	Long. (^o)	-115.66	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020089	Metagenome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334917_062144_224_400	F020089	N/A	MKYEDPFEWTPRSEAWVEAAGWIAEDRRARLRGDATEEAFARLAFQLCMQQAAETDAQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.