| Basic Information | |
|---|---|
| Taxon OID | 3300034384 Open in IMG/M |
| Scaffold ID | Ga0372946_0171146 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1041 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Eldorado National Forest, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.9738 | Long. (o) | -120.4934 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049264 | Metagenome / Metatranscriptome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0372946_0171146_3_374 | F049264 | AGGAGG | MRFITAILAGVFLVPVGIGTAQAVPPSAVVLPTKATLLADGSVQIMMKVRCNDQQQAFEWSVEIRQGTIYGNDSAGPVAGLITCDGKFHTVDALVPGANGPYTAGPADVQALVQLFDAVEGSDV |
| ⦗Top⦘ |