Scaffold Ga0326788_019252

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326788_019252

Scaffold Ga0326788_019252

Overview

Basic Information
Taxon OID	3300034364 Open in IMG/M
Scaffold ID	Ga0326788_019252 Open in IMG/M
Source Dataset Name	Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S13 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	720
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	36.0	Long. (^o)	-78.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007957	Metagenome / Metatranscriptome	341	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326788_019252_105_719	F007957	AGAAG	VNLFGFCGYVSGITIADDPQLTGQKFAIVEFWDKNAAITACLLSSAIVQNQPIHVELYVANETDQQNISAHPELKSKGVPPVVDNAAKQSGTATVARVLASGIVLSKDVKEKAVAWDTGNLNLIQKAEVLGLHAKSNIEEINRQYHITDTVEELAKIAEKKLLELKTTIEANENFQAAKTKALELDSQYGISITALNMFEKAKST

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.