NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335013_0273299

Scaffold Ga0335013_0273299


Overview

Basic Information
Taxon OID3300034284 Open in IMG/M
Scaffold IDGa0335013_0273299 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1086
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008991Metagenome / Metatranscriptome324N
F017436Metagenome / Metatranscriptome240N
F057096Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0335013_0273299_190_657F008991N/AMHLTVKITEQVEKKLEAVLKGKYDNKTIWMYYKVSLQLLRGIIENLIACHHTTYPLAEKDLYYEQNKVQIVDWIQWIQNRTSSDKLVDLDKLLSKLIKDKAENLVEALTEENPSDRMTTLSMLQMSIQMALFTEVQQLLRSPIVIQFCEENGWAV
Ga0335013_0273299_2_187F057096N/AGDCEICDLEKILGEESLEIAEAVKVALSNRNEETRNRILGELLEKTITKIEALSVRVSPA
Ga0335013_0273299_641_1039F017436N/AMDGQYREMFRETVITVQRLSVSAAVFTVTERRNNIVPQKTTTRCRTVVKMMINEIKDDIATLSRNSDRYRFKRIQLALYILLSEALSIEGSNERYKGLKDMYYFMDRLKTTTFDEWKNFLITGSTEFFDNRF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.