| Basic Information | |
|---|---|
| Taxon OID | 3300034282 Open in IMG/M |
| Scaffold ID | Ga0370492_0029732 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2247 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 63.8785 | Long. (o) | -149.2588 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072177 | Metagenome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0370492_0029732_867_1016 | F072177 | AGCAGG | MDSTNRKIFWILFTILSLGGYFLPFGWAIAEMFVSLFVSWWVVYRSGLL |
| ⦗Top⦘ |