Scaffold Ga0372943_1196792

Overview

Basic Information

• Taxon OID: 3300034268
• Scaffold ID: Ga0372943_1196792
• Source Dataset Name: Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 508
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Eldorado National Forest, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.7833
  • Long. (^o): -120.2976
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088578	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0372943_1196792_2_340	F088578	N/A	EPQHNGGLTFLDGELSEVALDDAEASSFLALVGDLDAVTVSACPDCRSRILAAVALVDLLDAAPPHPRASELVELADEAPTLHVYLVDEAKECTHEAWLDPGFDEWADAVEP