NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334947_077249

Scaffold Ga0334947_077249


Overview

Basic Information
Taxon OID3300034251 Open in IMG/M
Scaffold IDGa0334947_077249 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)683
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.3778Long. (o)-117.6098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007509Metagenome / Metatranscriptome350Y

Sequences

Protein IDFamilyRBSSequence
Ga0334947_077249_1_681F007509N/AGFLPALEQAISDAASEANVRFEPNAIARLRQRLGIERMLADKFSKDVPSLRIAMSEAERLITLAGTGGRVTPDMIDREVASVEGGARYEFGSLYTEGKIVEAIVKLRDLIAQARREDPKMPLDMQYGKFLFPLADEIRQMIGIHSFAKLQKIDVRAPMNYNRFKDTLADRLGDYLKSHGLVRQRPHPFPLHKKWEAARAHDEPSLFRALAAVADMEVKRKSGGLPVD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.