NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334937_183633

Scaffold Ga0334937_183633


Overview

Basic Information
Taxon OID3300034221 Open in IMG/M
Scaffold IDGa0334937_183633 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 33SMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)579
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001264Metagenome / Metatranscriptome735Y
F012099Metagenome / Metatranscriptome283Y

Sequences

Protein IDFamilyRBSSequence
Ga0334937_183633_193_432F001264AGGAGMRPEQTVNEMAQVVLWRQAKAQALRTGQSHASARAAVIQTPGGCQLEELRTGLHQHEEARYWQANLLFERVSEQAGHPV
Ga0334937_183633_2_178F012099N/AGAFVHDIREHEGRLTDKFTHPWFYDATERAQQHEHDEAAHLEGSRWRYNDITAASNEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.