NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334937_026310

Scaffold Ga0334937_026310


Overview

Basic Information
Taxon OID3300034221 Open in IMG/M
Scaffold IDGa0334937_026310 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 33SMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1537
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003047Metagenome510Y
F028302Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
Ga0334937_026310_156_590F003047N/AMWTNTTSARVPVIYPESSENICRIGHTDTGREEEFMTGDALVEEINAAYVRLETAAEELARADHKLAEHVSRVRLDNAEAILEARNERTASLYLDGMLDTEEHHRLQTERTRAELDLQHARREVERLHLIVRLLGTQTGEGTQD
Ga0334937_026310_581_877F028302AGTAGLSTSIERKEPTVADVHVYVNRTAAKEGTALEDLGEALRKLDYVSDVDINAPGNVVAVSFEGGKAEQEEIKDTVEEAGYEVSRLSVRSTISEERNLWDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.