| Basic Information | |
|---|---|
| Taxon OID | 3300034199 Open in IMG/M |
| Scaffold ID | Ga0370514_157047 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 588 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 64.9123 | Long. (o) | -147.839 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015443 | Metagenome / Metatranscriptome | 254 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0370514_157047_1_477 | F015443 | GGAGG | MSGKRLALLVVPVVLLISSALAQVNEVSLTAGRTFVSTQTNQADGLPVHFGNEETVAANYGRLLKTHKIFGIYAELPVAIYFRMDVNTNIGTSPKDVGALFATPSVRVNIFSGDSVTPWVSAGGGFGHFRVAPETLYNNPNPGSGSNTGVIQFGAGLDT |
| ⦗Top⦘ |