| Basic Information | |
|---|---|
| Taxon OID | 3300034173 Open in IMG/M |
| Scaffold ID | Ga0334925_089741 Open in IMG/M |
| Source Dataset Name | Biocrust microbial communities from Mojave Desert, California, United States - 21HNC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 662 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.7856 | Long. (o) | -115.66 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003133 | Metagenome / Metatranscriptome | 505 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334925_089741_279_614 | F003133 | AGG | MNSLKVRREKMSENIDKDQQRKDAAKTLLGNVSCVVGLLSGAGGILFALLGASDNVSAGAVGAALGILGYFFGARRLGVAAIALGVIAVFFMAAASTGLIPGVTPLGHGYD |
| ⦗Top⦘ |