NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334925_007385

Scaffold Ga0334925_007385


Overview

Basic Information
Taxon OID3300034173 Open in IMG/M
Scaffold IDGa0334925_007385 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 21HNC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2516
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002864Metagenome / Metatranscriptome525Y
F016872Metagenome / Metatranscriptome244Y

Sequences

Protein IDFamilyRBSSequence
Ga0334925_007385_1083_1418F016872AGGAGGMQDDKSAQDAKRLLEAFSINHDEARTISPHGAHRPFIPNWADAEHAGLDRVRRDDAMGWLVNKGMLERDEESENLLVTGEGFPDYGFGSVFRITDSGRELLEEIWQESGHQ
Ga0334925_007385_1451_1624F002864N/AVLEELESVRRYTRAEVLDIPTLRYVAMETHKPALVSWIDRHQAEYGRGLLDGFRAED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.