Scaffold Ga0335017_0426634

Overview

Basic Information

• Taxon OID: 3300034167
• Scaffold ID: Ga0335017_0426634
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 714
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.0995
  • Long. (^o): -89.4045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060618	Metagenome	132	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0335017_0426634_3_293	F060618	GAG	MLMPEDGHFECMEADCGFRTCDLFEFMYHCGVEYKWAVRLDKRYSFDLFEFLQILNDIIDVGDLDEAYDHIQSATLLMVNASGDDLHEFIEEAVVRS