Scaffold Ga0364940_0178141

Overview

Basic Information

• Taxon OID: 3300034164
• Scaffold ID: Ga0364940_0178141
• Source Dataset Name: Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 618
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.9229
  • Long. (^o): -106.9499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016898	Metagenome / Metatranscriptome	244	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0364940_0178141_348_602	F016898	GGGGG	MDDTLRQTQVKWLYCFACGEPFELLGLGSTCGCGRSAACLDEGILEIEGPAHALAPVESIVRVDGGEWAFVPEGIPIRRRLPRT