Scaffold Ga0364933_005611

Overview

Basic Information

• Taxon OID: 3300034150
• Scaffold ID: Ga0364933_005611
• Source Dataset Name: Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2827
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.9229
  • Long. (^o): -106.9499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027329	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0364933_005611_460_915	F027329	GGAGG	MTSSRAEALMLLPDWARRLSAKGAVDFTETLQGSWRRDGEELDRPIHLVLRHQAASARRLLESGAMETLGEVSLDGLTAPVRGTRRVSWRTGRVDIELVSDGFRFIGGLHNLLWRGEPYRFRIETLAGAPVGDAILRPRLATAQPEVPAAP