Scaffold Ga0334929_000970

Overview

Basic Information

• Taxon OID: 3300034135
• Scaffold ID: Ga0334929_000970
• Source Dataset Name: Biocrust microbial communities from Mojave Desert, California, United States - 25HNC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8278
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.3778
  • Long. (^o): -117.6098

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051828	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334929_000970_480_677	F051828	GGAGG	MEESKPRDLITASEARSLLRVSRIKMATLLKSGTLRHYPNPLDNRVKLVSKAEVLSLIPERAEAA