| Basic Information | |
|---|---|
| Taxon OID | 3300034131 Open in IMG/M |
| Scaffold ID | Ga0334911_007292 Open in IMG/M |
| Source Dataset Name | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1467 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.7856 | Long. (o) | -115.66 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039022 | Metagenome | 164 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334911_007292_443_883 | F039022 | N/A | MAAAVLIALANAILYSLIGNNTFSNLFEFHFDPWYLTAMYVFCAVFVGLLVAGGLIAFAEKVLRESFFARYGLMVLAICIGGAALAILLTTITFLFDDAAYVPRGVAETSYTLVLVTIPGATLGAIEGVILAFPLAWLLGLVGERN |
| ⦗Top⦘ |