Scaffold Ga0370490_0001137

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0370490_0001137

Scaffold Ga0370490_0001137

Overview

Basic Information
Taxon OID	3300034128 Open in IMG/M
Scaffold ID	Ga0370490_0001137 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11683
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	64.9144	Long. (^o)	-147.8354	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019854	Metagenome	227	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0370490_0001137_6811_7017	F019854	N/A	MLWVFERKGEQMRCEIRREGVGAGYEMIVTAPDGSQRMERFDETNDLIRRTLDLQRDLLETGWRQPKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.