Scaffold Ga0370484_0198745

Overview

Basic Information

• Taxon OID: 3300034125
• Scaffold ID: Ga0370484_0198745
• Source Dataset Name: Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 548
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 64.9095
  • Long. (^o): -147.9448
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012726	Metagenome / Metatranscriptome	278	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0370484_0198745_93_299	F012726	GGAGG	VPGDADAVRATGVSDDALRDAVTVCSLFSMIVRLADSLGWDVPDWESLKLRAPAMLEGGYAPQAVGKR