Scaffold Ga0370484_0000014

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0370484_0000014

Scaffold Ga0370484_0000014

Overview

Basic Information
Taxon OID	3300034125 Open in IMG/M
Scaffold ID	Ga0370484_0000014 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	55792
Total Scaffold Genes	66 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	40 (60.61%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	64.9095	Long. (^o)	-147.9448	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016445	Metagenome	247	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0370484_0000014_30188_30409	F016445	N/A	MSLIRKKTRISAKRVAEIIGCSEKTVYNRGAGTDKLTRIRNGRRQIRFILEEVLAFTERQEKEARRSHNARNN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.