NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335036_0023942

Scaffold Ga0335036_0023942


Overview

Basic Information
Taxon OID3300034106 Open in IMG/M
Scaffold IDGa0335036_0023942 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4869
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010835Metagenome / Metatranscriptome298N
F013879Metagenome / Metatranscriptome267N
F023575Metagenome / Metatranscriptome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0335036_0023942_2608_3084F023575N/AMALSKGLALVYGAKGTIKLYTVGVANALTEITTGTITTIESYDASHEADVEQIKNSAGEVVAQVSANERISLNITFIQSASTFAQAKLAASLPKVNGYAAIAGSDATTVGGGSIDGDYVYSGGGSVKFTSSGKVMVTITVTKYLDASALTGTAAVFTL
Ga0335036_0023942_3097_3579F010835AGGMNAVALRTERALVDWLSAQDWSASPLGTPACLTSYGHGAFTDPDLEDRMPDFPRIVVRSSTAVPVHPIDRTCEVDVTATLQLSADDTPEYNVLATVAAFENILQPLFVDDNISELNAGEYNESGGFVAYFATPTDFGINDTSERARTFSRSMTIFAAANS
Ga0335036_0023942_3576_4358F013879GGAGMTPTVTVDTSRFDAAWKEYLPKTRRSLADAVNSRTFFLMLRLYILLPPKSPQAARNKILDYFNRPIGARRIDKKTGKFLGRSRELRLVHLIAQAKNAKAGKPGLYGQDMRDAAGKLRRRAAGSVGYLKSAVTKAIKKLSPSFQQFGGTRRAKKGSAQVRIVAGNQALINLANQYGLPQENVSMHRGSSAYAYNAKAGFSPSSHVRLNIGLADNQIGKVEAIYAKAMQQAYNDEAKELEGHITAAFQAAFDGSESKGIVVQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.