NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335031_0057830

Scaffold Ga0335031_0057830


Overview

Basic Information
Taxon OID3300034104 Open in IMG/M
Scaffold IDGa0335031_0057830 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2784
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001259Metagenome / Metatranscriptome735Y
F013755Metagenome / Metatranscriptome268Y
F016253Metagenome / Metatranscriptome248Y

Sequences

Protein IDFamilyRBSSequence
Ga0335031_0057830_1654_1863F013755AGGAGVNNHIGDGNKMVSDTPISDSTPHNVADLAMLCRRFERFAAGRQARIDQLETENDAMRADLLLWNEKESK
Ga0335031_0057830_1860_2060F001259AGGAGMKDSPAFIYIHAFNGLIRVESLHTAKHVDQSPEWKHVATINPHVVLESILRATIKERNQIIKHILT
Ga0335031_0057830_865_1020F016253GGAGGMSDKIKSFIDSGTGVYSITKKEAGEIHKAAKKVKNYAFSYWTRNRKAKESK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.