NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335027_0157421

Scaffold Ga0335027_0157421


Overview

Basic Information
Taxon OID3300034101 Open in IMG/M
Scaffold IDGa0335027_0157421 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1660
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002259Metagenome / Metatranscriptome577Y
F006697Metagenome / Metatranscriptome366Y
F025017Metagenome / Metatranscriptome203N

Sequences

Protein IDFamilyRBSSequence
Ga0335027_0157421_1_150F025017N/AMASNINISYRQGIRNKGFQVTVPTTGASQTLSLSGLAKAFEGIRFSATTS
Ga0335027_0157421_165_704F006697N/AMANQVNKLAYVDSKLGVSLPGQQTTRVIYDSVNATAGQQFYEFFTNFAGKTEFQTNLTTNKLDSAESMVIKSVQIIMNSSTSTLADHLNLNITVGNQVVIKDFDPSFNSSNRGLAFDRLHSGLNDGKNLEFRLLTDIVIPPQVNFKATLQLGNALVALNDDITIIFKGYGRIFSAGNSF
Ga0335027_0157421_707_1267F002259N/AMGMSAQDKMITVANRLGLTSLKDMQGTTRMVYDSINVGTSVATLFKGAAQRAFPATNIGANGNQFQVDEALLVEKIGFFIPQDSAGLSYTGLSAGPFSIKFDLVIGNKTVIKDATCEVGGEQAFYNDGTSASSVIDLEGVGILIPPQVEYYVVAKAFNTSTRVATDSRIGCYLFGTGALLNFNTTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.