NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335025_0003588

Scaffold Ga0335025_0003588


Overview

Basic Information
Taxon OID3300034096 Open in IMG/M
Scaffold IDGa0335025_0003588 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11816
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005745Metagenome / Metatranscriptome391Y
F048943Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0335025_0003588_7954_8136F048943GAGMKIHLVSIEQDQSDVSEQMESLDPNSKDYAELDFEYNWLAGQIIATRHFIQIGEEHANKL
Ga0335025_0003588_8120_8404F005745GGAGMQTNFNPDYNLEEHIQLAVDMRVPALDIMHGELKNLMYEAELQLEEARRIEQDNHYSDAMQSMERTYAEGYIDALVHLYNLTYQLSFAIAEREE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.