NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335014_0161483

Scaffold Ga0335014_0161483


Overview

Basic Information
Taxon OID3300034094 Open in IMG/M
Scaffold IDGa0335014_0161483 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1088
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Anthocerotibacter → Anthocerotibacter panamensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014956Metagenome / Metatranscriptome258Y
F021732Metagenome / Metatranscriptome217Y
F041648Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0335014_0161483_134_391F014956GAGMNIQEFVINVTTTVCPSHIVEPLHLKKWWRQRGVGELEKYFVSGKAIHYNDEIDWNAISDHKKSLWYDSQNFQINMGHEYSKRQG
Ga0335014_0161483_388_738F041648N/AMEALANTLTDNALIRYYELRVKYLEGEQERLRNEARADYLITLDFWIYAQRIIEVYVMFHKDANHEHYLDMIKTILKNLEAHDEKALDTAINRLRLEVITRCNEAIIKCETIRENK
Ga0335014_0161483_763_1017F021732N/AMNITKYTVKCCLDKKLGHFVHVIFSSGFGLYGGNKPHHEDDNIEIHGWTFEPEDIDLSLYPVINTNNLMPLVDENEMDWVIIKN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.