NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335012_0002230

Scaffold Ga0335012_0002230


Overview

Basic Information
Taxon OID3300034093 Open in IMG/M
Scaffold IDGa0335012_0002230 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12203
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001706Metagenome / Metatranscriptome648Y
F100395Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0335012_0002230_11638_11907F100395AGGAGMADYIFKTPVIKEGPAGRHRLFYFYKLDKGISIAKSAGVYSQVRYVLDETMDDYQEFYLGGRNHVVDDTIKAALIAGGVGITEENFTAV
Ga0335012_0002230_11917_12201F001706AGGMKHWEYHPVYDETCFGCKAGTLQMNAGDATRDIPDKKWNAELQAYRDARDQGMRPAGTSMRHIREAHTASETLGKAYNSETMPKAKDINTKSVEV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.