Scaffold Ga0326724_0021750

Overview

Basic Information

• Taxon OID: 3300034091
• Scaffold ID: Ga0326724_0021750
• Source Dataset Name: Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5541
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.5488
  • Long. (^o): -76.2662
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014318	Metagenome / Metatranscriptome	264	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326724_0021750_5066_5245	F014318	N/A	MRVSKAPARRDMSDLYDKIKEDVTFRKMWAEKSRVGFELPAAVPNVPKITEKTEAAKAA