NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326724_0020814

Scaffold Ga0326724_0020814


Overview

Basic Information
Taxon OID3300034091 Open in IMG/M
Scaffold IDGa0326724_0020814 Open in IMG/M
Source Dataset NamePeat soil microbial communities from McLean, Ithaca, NY, United States - MB00N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5721
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031453Metagenome / Metatranscriptome182Y
F060151Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0326724_0020814_4585_4854F060151GGAGMTLLVASILLLVVGSIAARTIRTQNAPRPLSAADVEHGLKSAVPNARMAALVRQCGVDFELTVGVEKALRSAGANDNLILQIGRSQGVV
Ga0326724_0020814_5491_5721F031453N/AIHQHLDATLTLTIAGHRVGHYSEQGKLLTPLTKKQIKAVEKTLRGKVQKPTFPLNLQIPQNTRDSHFPTASTATNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.