Basic Information | |
---|---|
Taxon OID | 3300034091 Open in IMG/M |
Scaffold ID | Ga0326724_0017667 Open in IMG/M |
Source Dataset Name | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6476 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 42.5488 | Long. (o) | -76.2662 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006273 | Metagenome / Metatranscriptome | 377 | Y |
F088106 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326724_0017667_3301_3951 | F006273 | GGA | MSTTPRAIVSTRQESLLQRAKAFLGEAIFLVIHRFPRLLQLHRNEKSWTLFRVALACLGAAIVILPLSLWNGWITASFGLLLFVVAILLPPAELESGTDRKARELGAQTVVSGGEYQPGNGPAAEVRLFISPAHIWALDAHFDPLLVMSAPEISSLRVEEKGQRWLLQIRWADQKAEFAFAGFFAERFARLAEESIRAALPQKLPATPKRRAVSAA |
Ga0326724_0017667_36_419 | F088106 | GGA | VVPFVGGGIYVPYPVYMEGGAPAEPAAESSPAEAEQPPPAEETAARPADVAVRPYADSRAPAEPDSEYVFVRRDGTVFFAVAFTFDSANLRYVTRDGFRKTAPLASLDLAATQQFNEQRGLSPRLPS |
⦗Top⦘ |