Scaffold Ga0373913_0071858

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373913_0071858

Scaffold Ga0373913_0071858

Overview

Basic Information
Taxon OID	3300034089 Open in IMG/M
Scaffold ID	Ga0373913_0071858 Open in IMG/M
Source Dataset Name	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	910
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry → Uranium-Contaminated Sediments Microbial Communities After Treatment In Bioreactor, Oak Ridge, Tennessee, United States

Source Dataset Sampling Location
Location Name	USA: Oak Ridge, Tennessee
Coordinates	Lat. (^o)	36.0103	Long. (^o)	-84.2696	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063811	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373913_0071858_204_908	F063811	N/A	GLPWMFLYIGLVFLGFGVSASIISSLLFIRETKKYEVYNRSIEIYLLSKYLENILYITLGIALIIGTVYLWFFFLEKLVPVFSYFENESGSLVELKVNFEGMLKTLKTLLISFRDQFQYWCITSFLISLAGFTVPYMWFKGRRFTKIFLTLFLSGTTFSYLVSFLIQKFIITELTWIFVAVWTFSALITYMVFHLINTISLNKIIICRHCRTENIIDSKHCSECGKKLILVLKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.