Basic Information | |
---|---|
Taxon OID | 3300034088 Open in IMG/M |
Scaffold ID | Ga0373912_0079551 Open in IMG/M |
Source Dataset Name | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 834 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry → Uranium-Contaminated Sediments Microbial Communities After Treatment In Bioreactor, Oak Ridge, Tennessee, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oak Ridge, Tennessee | |||||||
Coordinates | Lat. (o) | 36.0103 | Long. (o) | -84.2696 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035821 | Metagenome | 171 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0373912_0079551_257_694 | F035821 | GGAGG | MTIDPAECRTWAQQVKAAWEVSPLIEMERGAQVQVGFELELYARLPTEIPPSAERRDAVEVIWERLRAIAESLLPLAGADARLEVDPFDAAARLRPETQFTPEVLLSARLFHGSNLLAPIQPGDRERLKPVEDRLRELGLKARNW |
⦗Top⦘ |